Print…

You Searched For: Trajan+Scientific+and+Medical


179,096  results were found

Refine Results Sort by
SearchResultCount:"179096"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-77123-734

Septin 1 Peptide

Catalog Number: (77123-734)
Supplier: Prosci
Description: Septin 1 Peptide
Image Unavailable-77129-006

Prestin Peptide

Catalog Number: (77129-006)
Supplier: Prosci
Description: Prestin Peptide
Image Unavailable-77123-066

Beclin 2 Peptide

Catalog Number: (77123-066)
Supplier: Prosci
Description: Beclin 2 Peptide
Image Unavailable-103009-976

HIV Beclin-1 Peptide

Catalog Number: (103009-976)
Supplier: Anaspec Inc
Description: Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. RELATED PRODUCTS:Beclin-1, Cat# 65466Tat-Beclin-1, scrambled, Cat# 65468
Sequence: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
MW: 3741.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103009-978

HIV Beclin-1 Peptide

Catalog Number: (103009-978)
Supplier: Anaspec Inc
Description: Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. Tat-Beclin-1, scrambled will not induce autophagy and can be used as a negative control. RELATED PRODUCTS:Tat-Beclin-1, Cat# 65467Beclin-1, Cat# 65466
Sequence: YGRKKRRQRRRGGVGNDFFINHETTGFATEW
MW: 3741.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-77127-410

Leptin Receptor Peptide

Catalog Number: (77127-410)
Supplier: Prosci
Description: Leptin Receptor Peptide
Product Image-EM1.07229.1000

Culture Media Bases, MilliporeSigma

Supplier: MilliporeSigma
Description: This line of culture media base products is produced in powdered and granular form.

SDS Certificates

Image Unavailable-89333-502

Anti-DECTIN-1 Rat Monoclonal Antibody [clone: 2A11]

Catalog Number: (89333-502)
Supplier: Genetex
Description: Rat monoclonal antibody [2A11] to Dectin-1
Image Unavailable-89353-992

Anti-CLEC7A Rabbit Polyclonal Antibody

Catalog Number: (89353-992)
Supplier: Genetex
Description: Rabbit polyclonal antibody to Dectin-1 (C-type lectin domain family 7, member A)
Image Unavailable-89363-518

Anti-DECTIN-1 Mouse Monoclonal Antibody [clone: GE2]

Catalog Number: (89363-518)
Supplier: Genetex
Description: Mouse monoclonal antibody [GE2] to Dectin-1
Image Unavailable-89307-446

Anti-DECTIN-1 Rat Monoclonal Antibody [clone: 2A11]

Catalog Number: (89307-446)
Supplier: Genetex
Description: Rat monoclonal antibody [2A11] to Dectin-1
Image Unavailable-10432-324

Anti-Nectin 3 Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10432-324)
Supplier: Bioss
Description: Nectins are immunoglobulin-like adhesion molecules that interact with afadin. Afadin is an actin filament-binding protein that connects nectins to the actin cytoskeleton. The nectin-afadin system organizes adherens junctions cooperatively with the cadherin-catenin system in epithelial cells.The nectin/PRR-family consists of four members, nectin-1, -2, -3 and -4. All the members of the nectin family have two or three slice variants. Nectin 3 is mainly expressed in testis and placental tissues and interacts in vivo with both long and short isoforms of afadin.
Image Unavailable-10432-328

Anti-Nectin 3 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10432-328)
Supplier: Bioss
Description: Nectins are immunoglobulin-like adhesion molecules that interact with afadin. Afadin is an actin filament-binding protein that connects nectins to the actin cytoskeleton. The nectin-afadin system organizes adherens junctions cooperatively with the cadherin-catenin system in epithelial cells.The nectin/PRR-family consists of four members, nectin-1, -2, -3 and -4. All the members of the nectin family have two or three slice variants. Nectin 3 is mainly expressed in testis and placental tissues and interacts in vivo with both long and short isoforms of afadin.
Image Unavailable-10341-848

Anti-CLEC6A Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10341-848)
Supplier: Bioss
Description: Dectin 2 is a type II transmembrane protein that is a member of the C type lectin superfamily. In mouse, dectin 2 is predominantly expressed on tissue macrophages and some dendritic cells. Significant expression of Dectin 2 has been reported on macrophages in the red pulp and marginal zones of the spleen, kupffer cells in the liver and alveolar macrophages in the lung. Peripheral blood monocytes express low levels of dectin 2 but transient up regulation of expression has been demonstrated on monocytes at sites of inflammation. The function of dectin 2 has not been fully determined but studies suggest a possible role in immune surveillance.
Image Unavailable-75789-468

Human Recombinant Nectin-2 (from Cells)

Catalog Number: (75789-468)
Supplier: Prosci
Description: CD112 is a type I transmembrane glycoprotein belonging to the Immunoglobulin superfamily. It comprises one Ig-like V-type domain and two Ig-like C2-type domains in the extracellular region. The V domain is believed to mediate nectin binding to its ligands. Nectin2 is known to bind the pseudorabies virus, and herpes simplex virus2 (HSV2), involving in cell to cell spreading of these viruses. It does not bind poliovirus. As a homophilic adhesion molecule, CD112 is found concentrated in adherens junctions, and exists on neurons, endothelial cells,epithelial cells and fibroblasts. CD112 has been identified as the ligand for DNAM-1 (CD226), and the interaction of CD226/CD112 mediates cytotoxicity and cytokine secretion by T and NK cells. The costimulatory responses may be a critical component in allergic reactions and may therefore become targets for anti-allergic therapy.
Image Unavailable-10432-312

Anti-Nectin 3 Rabbit Polyclonal Antibody

Catalog Number: (10432-312)
Supplier: Bioss
Description: Nectins are immunoglobulin-like adhesion molecules that interact with afadin. Afadin is an actin filament-binding protein that connects nectins to the actin cytoskeleton. The nectin-afadin system organizes adherens junctions cooperatively with the cadherin-catenin system in epithelial cells.The nectin/PRR-family consists of four members, nectin-1, -2, -3 and -4. All the members of the nectin family have two or three slice variants. Nectin 3 is mainly expressed in testis and placental tissues and interacts in vivo with both long and short isoforms of afadin.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
161 - 176 of 179,096
no targeter for Bottom