You Searched For: Kerosene - CAS 8008-20-6


9  results were found

SearchResultCount:"9"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (102999-806)
Supplier: Anaspec Inc
Description: Scrambled - beta - Amyloid (1 - 40), human, Sequence: AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, Apperance: Lyophilized white powder, freely soluble in basic buffer, Size: 1 mg


Catalog Number: (75794-030)
Supplier: Prosci
Description: BCMA, Recombinant Protein, Host: HEK293 cells, Reactivity: Human, Mouse, Sequence: aa 1-46 is fused at the C-term, Fusion Tag: Fc Tag, Purity: >95%(SDS-PAGE), Form: Lyophilized, Synonym: B Cell Maturation Protein, CD269, TNFRSF17, Buffer: Contains PBS, Size: 50ug


Catalog Number: (75794-042)
Supplier: Prosci
Description: Fas, Recombinant Protein, Host: HEK293 cells, Reactivity: Human, Mouse, Sequence: aa 26-170, Fusion Tag: Fc Tag, Purity: >95%(SDS-PAGE), Form: Lyophilized, Synonym: TNFRSF6, Apo-1 Antigen, CD95, Buffer: Contains PBS, Concentration: 1mg/ml reconstitution, Size: 50ug


Catalog Number: (102969-100)
Supplier: New England Biolabs (NEB)
Description: NEBNext* Ultra* II End Repair/dA-Tailing Module, Reagents Supplied: NEBNext Ultra II End Prep Enzyme Mix, NEBNext Ultra II End Prep Reaction Buffer, Optimized to convert 500 pg-1 ug of fragmented DNA to repaired DNA, Size: 96 reactions

Small Business Enterprise


Catalog Number: (200062-766)
Supplier: Enzo Life Sciences
Description: Used in Western blot with species reactivity to Human, Monkey, Mouse, Rat, Beluga, Bovine, Canine, Chicken, Fish, Guinea Pig, Hamster, Rabbit, Sheep.


Catalog Number: (76201-852)
Supplier: Enzo Life Sciences
Description: His(6) Monoclonal Antibody (6-His) (Purified), Applications: If, Format: Liquid, Phosphate-Buffered Solution Containing 0.03% Thimerosal, Antigen: His-Tag, Isotype: Igg1, Immunogenrecombinant Protein Containing The Sequence Hhhhhh, Size: 200Ul.


Catalog Number: (PAM2201)
Supplier: Promega Corporation
Description: Labeling in vitro, sequencing, mutagenesis, cDNA synthesis, flushing ends. 5-10units/uL. Size: 150 units. In a tamper-evident, plastic sealed packet that contains the enzyme tube, its buffer(s) and lot-specific Promega* Product Information. 24-month lifetime.

Catalog Number: (PAM2206)
Supplier: Promega Corporation
Description: Labeling in vitro, sequencing, mutagenesis, cDNA synthesis, flushing ends. 5-10units/uL. Size: 500 units. In a tamper-evident, plastic sealed packet that contains the enzyme tube, its buffer(s) and lot-specific Promega* Product Information. 24-month lifetime.

Catalog Number: (75794-116)
Supplier: Prosci
Description: Flagellin, Recombinant Protein, Host: E. Coli, Reactivity: Human, Mouse, Sequence: aa 1-495 is fused at N-term, Fusion Tag: His Tag, Purity: >95% by (SDS-PAGE), Synonym: FliC, Buffer: Contains PBS. Concentration : 0.1mg/ml after reconstitution, Size: 10ug


Catalog Number: (75842-422)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: CD289 (TLR9), Monoclonal Antibody, Clone: 72-1665, Host: Rat, Species Reactivity: Human, Isotype: IgG2a, kappa, Conjugate:PE, Formulation: Phosphate-buffered aqueous solution, </=0.09% Sodium azide, may contain carrier protein/stabilizer, ph7.2, Application: FC, Size: 100ug


Catalog Number: (75794-272)
Supplier: Prosci
Description: CD272 [BTLA], Recombinant Protein, Host: CHO cells, Reactivity: Human, Sequence: aa 31-157 N-term, Fusion Tag: Fc Tag, Purity: >98% (SDS-PAGE), Synonym: B- and T-lymphocyte attenuator, Buffer: Lyophilized from 0.2um-filtered solution in PBS, Size: 100ug


Catalog Number: (75789-382)
Supplier: Prosci
Description: Biglycan Recombinant Protein, Species: Human, Source: Human Cells, Sequence: Glu20-Lys368, Fusion Tag: C-6 His tag, Purity: Greater than 95% by reducing SDS-PAGE, Lyophilized, Synonyms: Bone/Cartilage Proteoglycan I, Application: For Biological Assays, Size: 50ug


Catalog Number: (10049-510)
Supplier: Enzo Life Sciences
Description: Monoclonal Antibody, Primary Antibody, Used in WB with species reactivity to Human, Mouse, Rat, Sheep, Dog, Pig, Monkey, Drosophila, Fish, Guinea pig, Hamster, horse, Host: Mouse, Immunogen: Recombinant human Hsp90, Isotype: IgG1


Catalog Number: (10049-530)
Supplier: Enzo Life Sciences
Description: Monoclonal Antibody, Primary Antibody, Used in IP, WB with species reactivity to Human, Mouse, Rat, Sheep, Dog, Monkey, Beluga, Bovine, Chicken, Fish, Guinea pig, Hamster, Rabbit, water mold, Host: Rat, Immunogen: Native mouse Hsp90, Isotype: IgM


Catalog Number: (75843-288)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: CD289 (TLR9), monoclonal Antibody, Clone: J43.1, Host: Armenian Hamster, Species reactivity: Mouse, Isotype: IgG, Conjugate: FITC, Formulation: Phosphate-buffered aqueous solution, </= 0.09% Sodium azide, carrier protein/stabilizer, pH 7.2, Application: FC, FA, Size: 25 ug


Catalog Number: (75794-274)
Supplier: Prosci
Description: CD272 [BTLA], Recombinant Protein, Host: CHO cells, Reactivity: Human, Sequence: aa 31-157, Fusion Tag: Fc Tag, Purity: >98% (SDS-PAGE), Synonym: BTLA, B- and T-lymphocyte attenuator, Buffer: Lyophilized from 0.2um-filtered solution in PBS, Size: 100ug


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
no targeter for Bottom