646  results were found

SearchResultCount:"646"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (ALA163196-1G)
Supplier: ALADDIN SCIENTIFIC
Description: Aldeyde PEG is an amine reactive PEG derivative that can be used to modify biomolecules via available amine groups. The reaction between aldehyde group with ε-amine of lysine residues and the α-amine at the N-terminus produces an intermediate Schiff base. Further reduction with hydride will form a stable C-N bond. PEG aldehydes react with amine groups at a pH of from 5.5 to 9.5. Higher pH will result in multiple Pegylation with both terminal and lysine groups. Aldehyde PEG is a commonly used PEG reagent for n-terminus pegylation in proteins or peptides.

New Product


Catalog Number: (76482-202)
Supplier: AAT BIOQUEST INC
Description: This green fluorescent cGMP derivative is a specific substrate for phosphodiesterase (PDE) V.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (76481-340)
Supplier: AAT BIOQUEST INC
Description: TQ4WS is designed to be a superior quencher to ROX, TF4, iFluor® 594, Alexa Fluor® 594 and Texas Red®.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (ALA163214100MG)
Supplier: ALADDIN SCIENTIFIC
Description: Alkyne functionalized polyethylene glycol (Alk-PEG-X) is a bifunctional PEG derivative that can be used to modify proteins, peptides and other materials via Click Chemistry. Alkyne group can react with azide in aqueous solution catalyzed by copper. PEGylation can increase solubility and stability and reduce immunogenicity of peptides and proteins. It can also suppress the non-specific binding of charged molecules to the modified surfaces.

New Product


Catalog Number: (76481-520)
Supplier: AAT BIOQUEST INC
Description: Tide Fluor™ 8WS (TF8WS) family has the spectral properties similar to those of IRDye 800.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (76481-512)
Supplier: AAT BIOQUEST INC
Description: Tide Fluor™ 6 (TF6WS) family has the spectral properties similar to those of Cy5.5, IRDye 700 and Alexa Fluor 680.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Supplier: Ambeed
Description: 5(6)-Carboxyfluorescein N-hydroxysuccinimide ester (5/6-FAM SE) ≥95% (mixture of isomers)

New Product

Catalog Number: (76482-198)
Supplier: AAT BIOQUEST INC
Description: This green fluorescent cAMP derivative is a specific substrate for phosphodiesterase (PDE) IV.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Supplier: AAT BIOQUEST INC
Description: There are several ways of labeling an oligonucleotide with fluorescein.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (89139-566)
Supplier: Biotium
Description: 5-FAM SE is an amine-reactive form of 5-carboxyfluorescein single isomer.


Catalog Number: (76485-704)
Supplier: AAT BIOQUEST INC
Description: Fluorescein aldehyde is a reactive fluorescent dye that can react with an amine, hydrazine or hydroxylamine.

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Catalog Number: (89139-556)
Supplier: Biotium
Description: 6-FAM, SE (full name: 6-Carboxyfluorescein, succinimidyl ester, single isomer) is the amine-reactive form of 6-carboxyfluorescein single isomer.
6-FAM SE is an amine-reactive green fluorescent dye widely used for labeling oligonucleotides or other biomolecules that contain a primary or secondary aliphatic amine. The coupling reaction is usually carried out at pH 8-9.5.


Supplier: Invitrogen
Description: NHS fluorescein [(5/6-carboxyfluorescein succinimidyl ester), mixed isomer] is an amine reactive derivative of fluorescein dye for antibodies and other probes in fluorescence microscopy, flow cytometry, and immunofluorescence based assays such as western blotting and ELISA.
Catalog Number: (103007-782)
Supplier: Anaspec Inc
Description: This FAM labeled peptide (Abs/Em=492/518 nm) is composed of gp91phox sequence linked to the human immunodeficiency virus (HIV)-tat peptide. The tat sequence facilitates the entry of this peptide into all cells. It is used as a peptide inhibitor for NADPH oxidase assembly.
Sequence: 5-FAM-YGRKKRRQRRRCSTRIRRQL-NH2
MW: 3031.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103005-918)
Supplier: Anaspec Inc
Description: This full length Exendin 4 amide peptide is labeled with a fluorescent dye (FAM), Abs/Em = 494/519 nm, on its N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4545 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (103009-020)
Supplier: Anaspec Inc
Description: This peptide is a 5-FAM-labeled cylic RGDyK peptide. RGD peptides serve as ligands for av-integrin and inhibit angiogenesis, induce endothelial apoptosis, decrease tumor growth, and reduce spread of metastasis.
Sequence:Cyclo[-RGDy-K(5-FAM)]
MW:978 Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16 of 646
no targeter for Bottom