You Searched For: 2-(3-Methylisoxazol-5-yl)acetic+acid

Catalog Number: (103005-944)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 7, 8, 12, 13 and 14 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520 -γ-Abu-PQGL-Dab(5-FAM)-AK-NH2
MW:1647.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-064)

Supplier: Anaspec Inc

Description: This is a fluorescent 5-FAM labeled scrambled Beta-Amyloid peptide, Abs/Em=494/521 nm.
Sequence: 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
MW: 4873.4
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103008-144)

Supplier: Anaspec Inc

Description: This peptide is histone H4 amino acid residues 1 to 21. It is monomethylated at Lys-12 with a C-terminal GG linker, followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SGRGKGGKGLG-K(Me1)-GGAKRHRKV-GGK(Biotin)
MW:2616.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-552)

Supplier: Anaspec Inc

Description: This is the H-2Db restricted epitope derived from the lymphocytic choriomeningitis virus (LCMV) glycoprotein gp 33; residues 33 to 41.
Sequence:KAVYNFATM
MW:1044.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-108)

Supplier: Anaspec Inc

Description: This is a 5-FAM labeled ß-?Amyloid (1-40). This amidated peptide is also biotinylated on the lysine side chain with 6-aminohexanoate (LC) as a spacer, Ex/Em=490 nm/ 520 nm.
Sequence: 5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(LC-BIOTIN)-NH2
Molecular Weight: 5154.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1 to 21 mono-methylated at Lys-9 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)
MW:2737.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-080)

Supplier: Anaspec Inc

Description: The synthetic peptide (Tat-Glur23Y) contains tyrosine residues that blocks phosphorylation of alpha-amino-3-hydroxy-5-methyl-isoxazole-4-propionic acid (AMPA) receptor endocytosis. Previous research shows that Tat-Glur23Y blocks regulated AMPA and thereby prevents long-term depression (LTD) in structures such as the nucleus accumbens and dorsal hippocampus.
Sequence: YGRKKRRQRRRYKEGYNVYG
MW: 2634 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103007-750)

Supplier: Anaspec Inc

Description: This is a control peptide for gp91 ds-tat.
Sequence: YGRKKRRQRRRCLRITRQSR-NH2
MW: 2673.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103008-228)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 with amino acid residues 69 to 89 di-methylated at Lys-79 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RLVREIAQDF-K(Me2)-TDLRFQSSAV-K(Biotin)
MW:2862.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-188)

Supplier: Anaspec Inc

Description: This peptide is beta-Amyloid (1-10), human sequence.
Sequence: DAEFRHDSGY
Molecular Weight: 1196.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-214)

Supplier: Anaspec Inc

Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103008-022)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-9.
Sequence:TKQTAR-K(Me1)-STGGKAPR
MW:1600.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-282)

Supplier: Anaspec Inc

Description: Angiotensin or Ang (1-7), DRVYIHP, is a cleavage product from either Angiotensin (Ang) I or Angiotensin (Ang) II. Ang (1-7) acts as a vasodilator, inhibitor of protein synthesis or as a natriuretic agent. Ang (1-7) acts through its G-protein coupled receptor, Mas.
Sequence: DRVYIHP
MW: 899 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103008-338)

Supplier: Anaspec Inc

Description: This peptide is Histone H4 amino acid residues 1 to 23. It is dimethylated at lysine 20 with a C-terminal GG linker, followed by a biotinylated lysine. The dimethylation of histone H3 at lysine 20 is needed for Crb2 (fission yeast checkpoint protein) loca
Sequence:SGRGKGGKGLGKGGAKRHR-K(Me2)-VLR-GGK(Biotin)-NH2
MW:2856.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-354)

Supplier: Anaspec Inc

Description: Angiotensin (Ang) III, RVYIHPF, is derived from the N-terminal cleavage of AngII, DRVYIHPF, through the action of aminopeptidase A (APA). AngIII is the main effector in the brain renin-angiotensin system (RAS) for vasopressin release.
Sequence: RVYIHPF
MW: 931.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This peptide is a neurotoxin that blocks N-type calcium channels.
Sequence:CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY-NH2
MW:3037.4 Da
% peak area by HPLC:95
Storage condition:-20° C