You Searched For: 3-Fluoro-5-methoxyisonicotinic+acid


265,218  results were found

SearchResultCount:"265218"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103005-944)
Supplier: Anaspec Inc
Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 7, 8, 12, 13 and 14 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520 -γ-Abu-PQGL-Dab(5-FAM)-AK-NH2
MW:1647.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-064)
Supplier: Anaspec Inc
Description: This is a fluorescent 5-FAM labeled scrambled Beta-Amyloid peptide, Abs/Em=494/521 nm.
Sequence: 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
MW: 4873.4
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103008-144)
Supplier: Anaspec Inc
Description: This peptide is histone H4 amino acid residues 1 to 21. It is monomethylated at Lys-12 with a C-terminal GG linker, followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SGRGKGGKGLG-K(Me1)-GGAKRHRKV-GGK(Biotin)
MW:2616.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-552)
Supplier: Anaspec Inc
Description: This is the H-2Db restricted epitope derived from the lymphocytic choriomeningitis virus (LCMV) glycoprotein gp 33; residues 33 to 41.
Sequence:KAVYNFATM
MW:1044.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-108)
Supplier: Anaspec Inc
Description: This is a 5-FAM labeled ß-?Amyloid (1-40). This amidated peptide is also biotinylated on the lysine side chain with 6-aminohexanoate (LC) as a spacer, Ex/Em=490 nm/ 520 nm.
Sequence: 5-FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(LC-BIOTIN)-NH2
Molecular Weight: 5154.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 21 mono-methylated at Lys-9 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)
MW:2737.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-080)
Supplier: Anaspec Inc
Description: The synthetic peptide (Tat-Glur23Y) contains tyrosine residues that blocks phosphorylation of alpha-amino-3-hydroxy-5-methyl-isoxazole-4-propionic acid (AMPA) receptor endocytosis. Previous research shows that Tat-Glur23Y blocks regulated AMPA and thereby prevents long-term depression (LTD) in structures such as the nucleus accumbens and dorsal hippocampus.
Sequence: YGRKKRRQRRRYKEGYNVYG
MW: 2634 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103007-750)
Supplier: Anaspec Inc
Description: This is a control peptide for gp91 ds-tat.
Sequence: YGRKKRRQRRRCLRITRQSR-NH2
MW: 2673.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103008-228)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 with amino acid residues 69 to 89 di-methylated at Lys-79 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RLVREIAQDF-K(Me2)-TDLRFQSSAV-K(Biotin)
MW:2862.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-188)
Supplier: Anaspec Inc
Description: This peptide is beta-Amyloid (1-10), human sequence.
Sequence: DAEFRHDSGY
Molecular Weight: 1196.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103007-214)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103008-022)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-9.
Sequence:TKQTAR-K(Me1)-STGGKAPR
MW:1600.8 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-282)
Supplier: Anaspec Inc
Description: Angiotensin or Ang (1-7), DRVYIHP, is a cleavage product from either Angiotensin (Ang) I or Angiotensin (Ang) II. Ang (1-7) acts as a vasodilator, inhibitor of protein synthesis or as a natriuretic agent. Ang (1-7) acts through its G-protein coupled receptor, Mas.
Sequence: DRVYIHP
MW: 899 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103008-338)
Supplier: Anaspec Inc
Description: This peptide is Histone H4 amino acid residues 1 to 23. It is dimethylated at lysine 20 with a C-terminal GG linker, followed by a biotinylated lysine. The dimethylation of histone H3 at lysine 20 is needed for Crb2 (fission yeast checkpoint protein) loca
Sequence:SGRGKGGKGLGKGGAKRHR-K(Me2)-VLR-GGK(Biotin)-NH2
MW:2856.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103003-354)
Supplier: Anaspec Inc
Description: Angiotensin (Ang) III, RVYIHPF, is derived from the N-terminal cleavage of AngII, DRVYIHPF, through the action of aminopeptidase A (APA). AngIII is the main effector in the brain renin-angiotensin system (RAS) for vasopressin release.
Sequence: RVYIHPF
MW: 931.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Supplier: Anaspec Inc
Description: This peptide is a neurotoxin that blocks N-type calcium channels.
Sequence:CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY-NH2
MW:3037.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
33 - 48 of 265,218
no targeter for Bottom