Human beta-CGRP

Supplier: AnaSpec
AS-64563-05
103008-238EA 321.54 USD
103008-238
Human beta-CGRP
Proteins and Peptides
This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Sequence:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:3793.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Order Now

Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR