Anti-UBE2S Rabbit Polyclonal Antibody

Supplier: Novus Biologicals
NBP1-55056
102185-062EA 564.74 USD
102185-062
Anti-UBE2S Rabbit Polyclonal Antibody
Antibodies
The UBE2S Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBE2S. This antibody reacts with human. The UBE2S Antibody has been validated for the following applications: Western Blot.

Type: Primary
Antigen: UBE2S
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human
Order Now

SPECIFICATIONS

Antigen Symbol UBE2S
Antigen Name Ubiquitin-conjugating Enzyme E2S
Antigen Synonyms Ubiquitin-conjugating enzyme E2-EPF5|Ubiquitin carrier protein S|ubiquitin-conjugating enzyme E2 S|ubiquitin-conjugating enzyme E2S|E2-EPF5|ubiquitin-conjugating enzyme E2-24 kD|E2-EPFEC 6.3.2.19|Ubiquitin-protein ligase S|Ubiquitin-conjugating enzyme E2-24 kDa|E2EPFEPF5
Antibody Type Primary
Clonality Polyclonal
Conjugation Unconjugated
Reactivity Human
Host Rabbit
Gene ID 27338
Isotype IgG
Western Blot Yes
Immunogen Synthetic peptides corresponding to UBE2S(ubiquitin-conjugating enzyme E2S) The peptide sequence was selected from the N terminal of UBE2S (NP_055316). Peptide sequence NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE.
Purification Immunogen affinity purified
Storage Buffer PBS & 2% Sucrose.
Storage Temperature Store at -20C. Avoid freeze-thaw cycles.

Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR