You Searched For: Nonidet®+P+40+Substitute+(NP-40)

24,662 results were found

Refine Results Sort by

Sort Results

List View Easy View

Compare(0) Clear

Rate These Search Results

Human [Cys26]-beta-Amyloid (1-40)

Catalog Number: (103007-636)

Supplier: Anaspec Inc

Description: Substitution of Ser 26 with Cys in Aβ1-40 allows the generation of the covalently linked Aβ40 homodimer. Dimerization can be reverted by adding a reducing agent. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Molecular Weight: 4345.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Retrieving Each

Pentasodium diethylenetriaminepentaacetate 40% in aqueous solution tech.

Supplier: Thermo Scientific Chemicals

Description: Pentasodium diethylenetriaminepentaacetate 40% in aqueous solution tech.

Gold ≥99.9%, disk, Diameter 40 mm

Supplier: Goodfellow

Description: Gold ≥99.9%, disk, Diameter 40 mm

New Product

PIPES lysis buffer with NP-40 (2X), Thermo Scientific

Catalog Number: (AAJ60568-AK)

Supplier: Thermo Scientific Chemicals

Description: Liquid

SDS Certificates

Retrieving Each

NP-40 lysis buffer, low salt, Thermo Scientific

Supplier: Thermo Scientific Chemicals

Description: Liquid

SDS Certificates

Petroleum spirit, 40…60 °C, extra pure

Supplier: Thermo Scientific Chemicals

Description: Petroleum spirit, 40…60 °C, extra pure

New Product

NP-40 lysis buffer with glycerol (2X), Thermo Scientific

Supplier: Thermo Scientific Chemicals

Description: Liquid

SDS Certificates

Human Beta-Amyloid (1-40)

Supplier: Anaspec Inc

Description: Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C